Beta-defensin 9 (Mus musculus)
Need Assistance?
  • US & Canada:
    +
  • UK: +

Beta-defensin 9 (Mus musculus)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Beta-defensin 9 is an antibacterial peptide isolated from Mus musculus.

Category
Functional Peptides
Catalog number
BAT-013709
Sequence
IIGVSEMERCHKKGGYCYFYCFSSHKKIGSCFPEWPRCCKNIK
1. Modulation of Human β-Defensin-1 Production by Viruses
Lisa Kathleen Ryan, Gill Diamond Viruses. 2017 Jun 21;9(6):153. doi: 10.3390/v9060153.
While initially identified as a broad-spectrum antimicrobial peptide, constitutively expressed in epithelia, human β-defensin (hBD)-1 is now recognized to have a more complex pattern of expression of its gene, DEFB1, as well as activities that extend beyond direct antimicrobial. These observations suggest a complex role for hBD-1 in the host defense against viral infections, as evidenced by its expression in cells involved in viral defense, and its gene regulation in response to viral challenge. This regulation is observed both in vitro and in vivo in humans, as well as with the murine homolog, mBD-1. While numerous reviews have summarized the existing literature on β-defensin gene expression and activity, here we provide a focused review of relevant studies on the virus-mediated regulation of hBD-1 and how this regulation can provide a crucial aspect of the innate immune defense against viral infection.
2. The synthetic peptides bovine enteric β-defensin (EBD), bovine neutrophil β-defensin (BNBD) 9 and BNBD 3 are chemotactic for immature bovine dendritic cells
Sarah Mackenzie-Dyck, Sam Attah-Poku, Veronique Juillard, Lorne A Babiuk, Sylvia van Drunen Littel-van den Hurk Vet Immunol Immunopathol. 2011 Sep 15;143(1-2):87-107. doi: 10.1016/j.vetimm.2011.06.028. Epub 2011 Jun 24.
Human and murine immature DCs (iDCs) are highly efficient in antigen capture and processing, while as mature cells they present antigen and are potent initiators of cell-mediated immune responses. Consequently, iDCs are logical targets for vaccine antigens. Originally discovered for their antimicrobial activity, and thought of as strictly part of the innate immune system, studies with defensins such as human β (beta)-defensin 2 (hBD2) and murine β-defensin 2 (mBD2) have shown that they can function as chemo-attractant for iDCs and, in vaccination strategies, can enhance antigen-specific adaptive immune responses. Most studies to date have been conducted in mice. In contrast, little is known about defensins in cattle. To expand our understanding of the role of defensins in modulating immune responses in cattle, DCs were generated from bovine monocytes and the immature state of these bovine DCs was characterized phenotypically and through functional assays. By day 3 (DC3), bovine monocyte-derived DCs stained positively for DC-specific receptors CD1, CD80/86, CD205, DC-Lamp and MMR. When compared to conventional 6-day DC cultures or DCs cultured for 10 days with and without maturation factors, these DC3 were functionally at their most immature stage. Fourteen of the 16 known bovine β-defensins were synthesized and the synthetic peptides were screened for their ability to attract bovine iDCs. Bovine DC3 were consistently attracted to BNBD3, an analog of BNBD3 (aBNBD3), BNBD9 and bovine EBD in vitro and to aBNBD3 in vivo. These results are the first to describe chemotactic ability of synthetic bovine β-defensins for immature bovine monocyte-derived DCs.
3. Mouse beta defensin-1 is a functional homolog of human beta defensin-1
G M Morrison, D J Davidson, F M Kilanowski, D W Borthwick, K Crook, A I Maxwell, J R Govan, J R Dorin Mamm Genome. 1998 Jun;9(6):453-7. doi: 10.1007/s003359900795.
Defensin are 3-4 kDa antimicrobial peptides of which three distinct families have been identified; alpha-defensin, beta-defensins, and insect defensins. Recent investigations have shown that beta-defensins are present in the human airways and may be relevant to the pathogenesis of cystic fibrosis (CF) lung disease. We report here the further characterization of a recently identified mouse beta-defensin gene, Defb1, sometimes referred to as mBD-1, which is homologous to the human airway beta defensin hBD-1. We report that Defb1 is expressed in a variety of tissues including the airways and, similar to hBD-1, is not upregulated by lipopolysaccharide (LPS). Defb1 was found to consist of two small exons separated by a 16-kb intron and cytogenetic, and physical mapping linked it to the alpha defensin gene cluster on mouse Chromosome (Chr) 8. Functional studies demonstrate that, like hBD-1, Defb1 demonstrates a salt-sensitive antimicrobial activity against Pseudomonas aeruginosa. Of relevance to CF lung disease is the fact that neither the hBD-1 nor the mBD-1 peptides are active against Burkholderia cepacia.
Online Inquiry
Verification code
Inquiry Basket