Need Assistance?

US & Canada:
+
UK: +

Our Highlights

GMP Grade Efficient workshop for GMP production.
Optimal Prices Buying products on this site guarantees the best price!
Commercial Batches Independent GMP manufacturing suites that handle commercial batches
Prompt Delivery Warehouses in multiple cities to ensure timely delivery
Flexible Quantity Quantities available from milligrams to ton

TGF α (1-50) (rat)

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

TGF α (1-50) (rat) was originally identified as an agent that can reversibly confer a transformed phenotype on normal non-tumor cells, such as normal rat renal fibroblasts. This activity requires the presence of transforming growth factor-β (TGF-β), which enhances the effects of TGF-α through a separate receptor. TGF-α is synthesized by monocytes, keratinocytes and a variety of tissues and tumors. (approx. ED50 = 0.2 ng/mL)

Category

Peptide Inhibitors

Catalog number

BAT-015210

CAS number

89899-53-6

Molecular Formula

C244H361N71O71S6

Molecular Weight

5617.38

Specification
Reference Reading

Synonyms

H-Val-Val-Ser-His-Phe-Asn-Lys-Cys-Pro-Asp-Ser-His-Thr-Gln-Tyr-Cys-Phe-His-Gly-Thr-Cys-Arg-Phe-Leu-Val-Gln-Glu-Glu-Lys-Pro-Ala-Cys-Val-Cys-His-Ser-Gly-Tyr-Val-Gly-Val-Arg-Cys-Glu-His-Ala-Asp-Leu-Leu-Ala-OH (Disulfide bridge: Cys8-Cys21, Cys16-Cys32, Cys34-Cys43); Transforming Growth Factor-α (1-50) from rat

Appearance

White or Off-white Lyophilized Powder

Sequence

VVSHFNKCPDSHTQYCFHGTCRFLVQEEKPACVCHSGYVGVRCEHADLLA (Disulfide bridge: Cys8-Cys21, Cys16-Cys32, Cys34-Cys43)

Storage

Store at -20°C

Solubility

Soluble in Water

1. Human transforming growth factor alpha (TGF-alpha) is digested to a smaller (1-43), less biologically active, form in acidic gastric juice

T Marchbank, H Hansen, R Boulton, R J Playford Gut . 2002 Dec;51(6):787-92. doi: 10.1136/gut.51.6.787.

Background:Transforming growth factor alpha (TGF-alpha) is a 50 amino acid peptide with potent proliferative and cytoprotective activity present in gastric mucosa and juice.Aims:To determine the forms and biological activity of natural and recombinant TGF-alpha following incubation with acid pepsin.Patients:Human gastric juice was obtained under basal conditions from patients taking acid suppressants and from volunteers undergoing intragastric neutralisation.Methods:Samples were analysed using mass spectroscopy and/or high pressure liquid chromatography with radioimmunoassay. Biological activity was determined using thymidine incorporation into rat hepatocytes and an indomethacin/restraint induced gastric damage rat model.Results:TGF-alpha(1-50) is cleaved to TGF-alpha(1-43) by acid pepsin and this is the predominant form in normal gastric juice. However, intragastric neutralisation or taking acid suppressants caused the predominant form to be TGF-alpha(1-50). TGF-alpha(1-43) had only half of the ability to maximally stimulate [(3)H]thymidine incorporation into primary rat hepatocytes (28 177 (1130) DPM/well for 2.16 nM TGF-alpha(1-43) v 63 184 (3536) DPM/well for TGF-alpha(1-50); p<0.001). A similar reduced potency was seen when used in an indomethacin induced rat gastric damage model (0.18 micro mol/kg/h of TGF-alpha(1-43) reduced ulcer area by 19% whereas TGF-alpha(1-50) reduced area by 62%; p<0.001).Conclusions:TGF-alpha(1-50) is cleaved to the TGF-alpha(1-43) form by acid pepsin, causing 2-5-fold loss of biological activity. Such changes may have relevance to the actions of acid suppressants and the importance of this peptide in both normal and abnormal growth.