Need Assistance?
  • US & Canada:
    +
  • UK: +

Arminin-1a

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Arminin-1a is a novel antimicrobial peptide discovered during investigations of the epithelial defense of the ancient metazoan Hydra.

Category
Functional Peptides
Catalog number
BAT-013519
Sequence
KPWRFRRAIRRVRWRKVAPYIPFVVKTVGKK
1. Arminin 1a-C, a novel antimicrobial peptide from ancient metazoan Hydra, shows potent antileukemia activity against drug-sensitive and drug-resistant leukemia cells
Xiaolei Liang, Ruirui Wang, Wenshan Dou, Li Zhao, Lanxia Zhou, Junfang Zhu, Kairong Wang, Jiexi Yan Drug Des Devel Ther. 2018 Oct 31;12:3691-3703. doi: 10.2147/DDDT.S181188. eCollection 2018.
Purpose: Due to the emergence of multidrug resistance (MDR), traditional antileukemia drugs no longer meet the treatment needs. Therefore, new antileukemia drugs with different action mechanisms are urgently needed to cope with this situation. Materials and methods: Arminin 1a-C is an antimicrobial peptide (AMP) developed from the ancient metazoan marine Hydra. In this study, we first explored its antileukemia activity. Results: Our results showed that Arminin 1a-C formed an α-helical structure and efficaciously suppressed the viability of leukemia cell lines whether or not they were multidrug resistant or sensitive, and there were no obvious differences between these cell lines. Arminin 1a-C exhibited distinct selectivity between noncancerous and cancerous cell lines. Arminin 1a-C interfered with K562/adriamycin (ADM) cell (a kind of multidrug-resistant leukemia cell line) proliferation in a very rapid manner and formed pores in its cell membrane, making it difficult to develop resistance against Arminin 1a-C. Conclusion: Our data show that Arminin 1a-C possesses great potential as a therapeutic candidate for the treatment of multidrug-resistant leukemia.
2. Activity of the novel peptide arminin against multiresistant human pathogens shows the considerable potential of phylogenetically ancient organisms as drug sources
René Augustin, Friederike Anton-Erxleben, Stephanie Jungnickel, Georg Hemmrich, Björn Spudy, Rainer Podschun, Thomas C G Bosch Antimicrob Agents Chemother. 2009 Dec;53(12):5245-50. doi: 10.1128/AAC.00826-09. Epub 2009 Sep 21.
The emergence of multidrug-resistant bacteria highlights the need for new antibacterial agents. Arminin 1a is a novel antimicrobial peptide discovered during investigations of the epithelial defense of the ancient metazoan Hydra. Following proteolytic processing, the 31-amino-acid-long positively charged C-terminal part of arminin 1a exhibits potent and broad-spectrum activity against bacteria, including multiresistant human pathogenic strains, such as methicillin-resistant Staphylococcus aureus (MRSA) strains (minimal bactericidal concentration, 0.4 microM to 0.8 microM). Ultrastructural observations indicate that bacteria are killed by disruption of the bacterial cell wall. Remarkably, the antibacterial activity of arminin 1a is not affected under the physiological salt conditions of human blood. In addition, arminin 1a is a selective antibacterial agent that does not affect human erythrocyte membranes. Arminin 1a shows no sequence homology to any known antimicrobial peptide. Because of its high level of activity against multiresistant bacterial strains pathogenic for humans, the peptide arminin 1a is a promising template for a new class of antibiotics. Our data suggest that ancient metazoan organisms such as Hydra hold promise for the detection of novel antimicrobial molecules and the treatment of infections caused by multiresistant bacteria.
Online Inquiry
Verification code
Inquiry Basket