Brain Natriuretic Peptide (BNP) (1-32), rat
Need Assistance?
  • US & Canada:
    +
  • UK: +

Brain Natriuretic Peptide (BNP) (1-32), rat

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Brain Natriuretic Peptide (BNP) (1-32), rat is a 32-amino acid polypeptide secreted by the ventricle in response to overstretching of cardiomyocytes.

Category
Peptide Inhibitors
Catalog number
BAT-010456
CAS number
133448-20-1
Molecular Formula
C146H239N47O44S3
Molecular Weight
3452.94
Brain Natriuretic Peptide (BNP) (1-32), rat
IUPAC Name
(3S)-3-[[(4R,10S,13S,16S,19S,22S,28S,31S,34S,37S,40S,43S,49S,52R)-40-(4-aminobutyl)-52-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-6-amino-2-[[(2S)-2-[[(2S)-2,4-diamino-4-oxobutanoyl]amino]-3-hydroxypropanoyl]amino]hexanoyl]amino]-4-methylsulfanylbutanoyl]amino]propanoyl]amino]-3-(1H-imidazol-4-yl)propanoyl]amino]-3-hydroxypropanoyl]amino]-3-hydroxypropanoyl]amino]-3-hydroxypropanoyl]amino]-43-(3-amino-3-oxopropyl)-49-benzyl-28,37-bis[(2S)-butan-2-yl]-13,31-bis(3-carbamimidamidopropyl)-34-(carboxymethyl)-16-(hydroxymethyl)-22-methyl-10-(2-methylpropyl)-6,9,12,15,18,21,24,27,30,33,36,39,42,45,48,51-hexadecaoxo-19-propan-2-yl-1,2-dithia-5,8,11,14,17,20,23,26,29,32,35,38,41,44,47,50-hexadecazacyclotripentacontane-4-carbonyl]amino]-4-[[2-[[(2S)-1-[[(2S)-5-carbamimidamido-1-[[(2S)-1-[[(1S)-1-carboxy-2-phenylethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopentan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-2-oxoethyl]amino]-4-oxobutanoic acid
Synonyms
Brain Natriuretic Peptide-32 (rat); BNP (1-32), rat; H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys(1)-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys(1)-Asp-Gly-Leu-Arg-Leu-Phe-OH; L-asparagyl-L-seryl-L-lysyl-L-methionyl-L-alanyl-L-histidyl-L-seryl-L-seryl-L-seryl-L-cysteinyl-L-phenylalanyl-glycyl-L-glutaminyl-L-lysyl-L-isoleucyl-L-alpha-aspartyl-L-arginyl-L-isoleucyl-glycyl-L-alanyl-L-valyl-L-seryl-L-arginyl-L-leucyl-glycyl-L-cysteinyl-L-alpha-aspartyl-glycyl-L-leucyl-L-arginyl-L-leucyl-L-phenylalanine (10->26)-disulfide
Appearance
White or Off-white Lyophilized Powder
Purity
95%
Density
1.5±0.1 g/cm3
Sequence
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: Cys10-Cys26)
Storage
Store in a cool and dry place and at 2-8°C for short term (days to weeks) or store at -20°C for long term (months to years)
Solubility
Soluble in Water
InChI
InChI=1S/C146H239N47O44S3/c1-16-75(11)114-140(233)165-59-107(201)167-77(13)117(210)191-113(74(9)10)141(234)189-102(67-198)134(227)176-86(38-29-46-160-145(154)155)124(217)179-90(49-71(3)4)119(212)162-62-110(204)171-103(138(231)182-95(56-111(205)206)121(214)164-61-109(203)170-91(50-72(5)6)129(222)173-85(37-28-45-159-144(152)153)125(218)180-92(51-73(7)8)130(223)184-97(143(236)237)53-80-33-22-19-23-34-80)68-239-240-69-104(139(232)181-93(52-79-31-20-18-21-32-79)120(213)163-60-108(202)169-88(40-41-105(150)199)126(219)172-84(36-25-27-44-148)127(220)193-115(76(12)17-2)142(235)183-96(57-112(207)208)132(225)174-87(128(221)192-114)39-30-47-161-146(156)157)190-137(230)101(66-197)188-136(229)100(65-196)187-135(228)99(64-195)186-131(224)94(54-81-58-158-70-166-81)178-116(209)78(14)168-122(215)89(42-48-238-15)177-123(216)83(35-24-26-43-147)175-133(226)98(63-194)185-118(211)82(149)55-106(151)200/h18-23,31-34,58,70-78,82-104,113-115,194-198H,16-17,24-30,35-57,59-69,147-149H2,1-15H3,(H2,150,199)(H2,151,200)(H,158,166)(H,162,212)(H,163,213)(H,164,214)(H,165,233)(H,167,201)(H,168,215)(H,169,202)(H,170,203)(H,171,204)(H,172,219)(H,173,222)(H,174,225)(H,175,226)(H,176,227)(H,177,216)(H,178,209)(H,179,217)(H,180,218)(H,181,232)(H,182,231)(H,183,235)(H,184,223)(H,185,211)(H,186,224)(H,187,228)(H,188,229)(H,189,234)(H,190,230)(H,191,210)(H,192,221)(H,193,220)(H,205,206)(H,207,208)(H,236,237)(H4,152,153,159)(H4,154,155,160)(H4,156,157,161)/t75-,76-,77-,78-,82-,83-,84-,85-,86-,87-,88-,89-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,113-,114-,115-/m0/s1
InChI Key
CKSKSHHAEYGHSB-LBCJMRPYSA-N
Canonical SMILES
CCC(C)C1C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NCC(=O)NC(CSSCC(C(=O)NC(C(=O)NCC(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)NC(C(=O)N1)CCCNC(=N)N)CC(=O)O)C(C)CC)CCCCN)CCC(=O)N)CC2=CC=CC=C2)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(CO)NC(=O)C(CC3=CNC=N3)NC(=O)C(C)NC(=O)C(CCSC)NC(=O)C(CCCCN)NC(=O)C(CO)NC(=O)C(CC(=O)N)N)C(=O)NC(CC(=O)O)C(=O)NCC(=O)NC(CC(C)C)C(=O)NC(CCCNC(=N)N)C(=O)NC(CC(C)C)C(=O)NC(CC4=CC=CC=C4)C(=O)O)CC(C)C)CCCNC(=N)N)CO)C(C)C)C
1. ANP(1-28), BNP(1-32) and CNP(1-22) increase the severity of picrotoxin-kindled seizure syndrome in rats
G Tóth, E Halászi, J Varga, A M Mazarati, G Telegdy Life Sci . 1993;52(3):PL19-24. doi: 10.1016/0024-3205(93)90227-t.
The administration of rANP(1-28) in doses of 1.0 and 2.0 nmol (but not 0.2 nmol) into the lateral cerebral ventricle (i.c.v) of rats preliminarily kindled with picrotoxin resulted in an increase of the severity of picrotoxin-kindled convulsions 24 hrs after injection of the peptide. I.c.v. injection of pBNP(1-32) also resulted in a proepileptic effect when it was applied in the same doses with a similar time course; the increased seizure severity was observed 48 hrs after injection of pBNP in a dose of 2 nmol. I.c.v. administration of CNP(1-22) in a dose of 2 nmol induced an increase in the severity of picrotoxin-kindled convulsions 24 and 48 hrs after application of the peptide. None of the peptides influenced the seizure syndrome immediately after the injections. It is presumed that the delayed proepileptic properties of the three natriuretic peptides could be caused by some of their stable fragments which accumulate during their metabolism.
2. Structure-activity studies on the effects of atrial natriuretic peptide, brain natriuretic peptide and their analogs on fear-motivated learning behavior in rats
G Tóth, J Gueron, J Varga, G Telegdy, A Bidzseranova Neuropeptides . 1992 Oct;23(2):61-5. doi: 10.1016/0143-4179(92)90079-c.
Our previous studies have demonstrated that rat atrial natriuretic peptide (rANP 1-28) and porcine brain natriuretic peptide (pBNP 1-32) administered into the lateral brain facilitate the consolidation of a passive avoidance response and delay the extinction of an active avoidance response in fear-motivated learning in rats. To study the structure-activity relationships in the same learning processes, the effects of several fragments related to ANP and BNP were investigated following their intracerebroventricular administration to rats. The following peptides were studied: rANP 1-28, rANP 5-28, rANP 5-27, rANP 7-23 (ring), rANP 17-23, hANP 10-28, hANP 15-28, hANP 20-28, hANP 1-28, pBNP 1-32 and pBNP 7-32. The peptides were used in equimolar concentration. Two of the peptides studied, ANP 20-28 and ANP 17-23, were ineffective on the extinction of active avoidance behavior and on the consolidation of passive avoidance learning. They exhibited similar actions. The results showed that small fragments of ANP and BNP can carry the biological activity of ANP and BNP on the central nervous system (CNS). It is likely that the biological active center for ANP lies between amino acids 15 and 23 and it is suspected that the ring structure is not absolutely important for the CNS activity.
3. [Expressions of BNP and NPR-A in rat models of chronic nonbacterial prostatitis and their significance]
Ming Ma, Xiao-Rong Yang, Ting Sun, Wen-Jie Xie Zhonghua Nan Ke Xue . 2012 Mar;18(3):204-7.
Objective:To investigate the expressions of brain natriuretic peptide (BNP) and natriuretic peptide receptor (NPR-A) in the cord dorsal horn ganglion (DRG) of rat models of chronic nonbacterial prostatitis (CNP) and the relation of BNP and NPR-A with CNP-induced chronic pain.Methods:We established CNP models in 30 healthy clean SD rats using Freund's complete adjuvant, and included another 10 in a sham-operation group. The prostate tissues were subjected to HE staining, and the expressions of BNP and NPR-A in the L5-S2 DRGs were detected by real-time PCR.Results:Higher degree of inflammation was related to longer modeling time. At 3, 7 and 10 days, the expressions of BNP in the CNP models were 2.16 +/- 0.35, 1.61 +/- 0.21 and 1.32 +/- 0.36, and those of NPR-A were 2.75 +/- 0.06, 2.15 +/- 0.15 and 1.04 +/- 0.13, respectively, significantly higher at 3 and 7 days as compared with the sham-operation group (P<0.05), but with no statistically significant difference at 10 days.Conclusion:BNP and NPR-A are expressed in the L5-S2 DRGs of SD rats and their expressions can be upregulated by CNP. BNP and NPR-A may be involved in the mechanisms of CNP-induced pain.
Online Inquiry
Inquiry Basket