Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif
Need Assistance?
  • US & Canada:
    +
  • UK: +

Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

The source of Chain A, Hevein-Type Antifungal Peptide With A Unique 10-Cysteine Motif is Triticum kiharae. It has antibacterial and antifungal activities.

Category
Functional Peptides
Catalog number
BAT-013390
Sequence
QRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGAGSCQSQCRGC
Online Inquiry
Verification code
Inquiry Basket