Need Assistance?
  • US & Canada:
    +
  • UK: +

Chicken AvBD7

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Chicken AvBD7 is an antibacterial peptide isolated from Gallus gallus, which belongs to the beta-defensin compound. It has activity against gram-positive bacteria and gram-negative bacteria.

Category
Functional Peptides
Catalog number
BAT-012865
Synonyms
Gln-Pro-Phe-Ile-Pro-Arg-Pro-Ile-Asp-Thr-Cys-Arg-Leu-Arg-Asn-Gly-Ile-Cys-Phe-Pro-Gly-Ile-Cys-Arg-Arg-Pro-Tyr-Tyr-Trp-Ile-Gly-Thr-Cys-Asn-Asn-Gly-Ile-Gly-Ser-Cys-Cys-Ala-Arg-Gly-Trp-Arg-Ser
Sequence
QPFIPRPIDTCRLRNGICFPGICRRPYYWIGTCNNGIGSCCARGWRS
1. Induction of Chicken Host Defense Peptides within Disease-Resistant and -Susceptible Lines
Hyun-Jun Jang, Melissa Monson, Michael Kaiser, Susan J Lamont Genes (Basel). 2020 Oct 14;11(10):1195. doi: 10.3390/genes11101195.
Host defense peptides (HDPs) are multifunctional immune molecules that respond to bacterial and viral pathogens. In the present study, bone marrow-derived cells (BMCs) and chicken embryonic fibroblasts (CEFs) were cultured from a Leghorn line (Ghs6) and Fayoumi line (M15.2), which are inbred chicken lines relatively susceptible and resistant to various diseases, respectively. The cells were treated by lipopolysaccharide (LPS) or polyinosinic-polycytidylic acid (poly(I:C)) and, subsequently, mRNA expression of 20 chicken HDPs was analyzed before and after the stimulation. At homeostasis, many genes differed between the chicken lines, with the Fayoumi line having significantly higher expression (p < 0.05) than the Leghorn line: AvBD1, 2, 3, 4, 6, and 7 in BMCs; CATH1, CATH3, and GNLY in CEFs; and AvDB5, 8, 9, 10, 11, 12, 13 in both BMCs and CEFs. After LPS treatment, the expression of AvBD1, 2, 3, 4, 5, 9, 12, CATH1, and CATHB1 was significantly upregulated in BMCs, but no genes changed expression in CEFs. After poly(I:C) treatment, AvBD2, 11, 12, 13, CATHB1 and LEAP2 increased in both cell types; CATH2 only increased in BMCs; and AvBD3, 6, 9, 14, CATH1, CATH3, and GNLY only increased in CEFs. In addition, AvBD7, AvBD14, CATH1, CATH2, GNLY, and LEAP2 showed line-specific expression dependent upon cell type (BMC and CEF) and stimulant (LPS and poly(I:C)). The characterization of mRNA expression patterns of chicken HDPs in the present study suggests that their functions may be associated with multiple types of disease resistance in chickens.
2. Systemic Administration of Avian Defensin 7: Distribution, Cellular Target, and Antibacterial Potential in Mice
Geoffrey Bailleul, et al. Front Microbiol. 2019 Mar 26;10:541. doi: 10.3389/fmicb.2019.00541. eCollection 2019.
Defensins are natural antimicrobial peptides. The avian beta-defensin AvBD7 isolated from the chicken bone marrow possess broad antibacterial spectrum and strong resistance to proteolysis. However, its ability to fight systemic infections of major concern for public health, such as salmonellosis, is unknown. As a first approach, fluorescence labeling of AvBD7 allowed to track its systemic distribution after intraperitoneal injection in mice using whole body live imaging. It was associated to peritoneal cells and to deeper organs such as the liver. In the next step, the use of labeled AvBD7 allowed to observe its interaction with murine macrophages in culture. After incubation, it was able to penetrate inside the cells through an endocytosis-like mechanism. Furthermore, natural AvBD7 contributed to the control of intracellular multiplication of a multidrug resistant Salmonella strain, after incubation with infected macrophages. Finally, administration in a model of systemic lethal Salmonella infection in mice led to significant improvement of mouse survival, consistently with significant reduction of the liver bacterial load. In conclusion, the results reveal a hitherto unknown intracellular antibacterial effect of AvBD7 in Salmonella target cells and support AvBD7 as a candidate of interest for the treatment of infectious diseases caused by multidrug-resistant pathogenic Enterobacteriaceae.
3. Primary structure and antibacterial activity of chicken bone marrow-derived beta-defensins
Chrystelle Derache, Valérie Labas, Vincent Aucagne, Hervé Meudal, Céline Landon, Agnès F Delmas, Thierry Magallon, Anne-Christine Lalmanach Antimicrob Agents Chemother. 2009 Nov;53(11):4647-55. doi: 10.1128/AAC.00301-09. Epub 2009 Sep 8.
Three biologically active beta-defensins were purified by chromatography from chicken bone marrow extract: avian beta-defensin 1 (AvBD1), AvBD2, and the newly isolated beta-defensin AvBD7. Mass spectrometry analyses showed that bone marrow-derived AvBD1, -2, and -7 peptides were present as mature peptides and revealed posttranslational modifications for AvBD1 and AvBD7 in comparison to their in silico-predicted amino acid sequences. Tandem mass spectrometry analysis using the nanoelectrospray-quadrupole time of flight method showed N-terminal glutaminyl cyclization of mature AvBD7 and C-terminal amidation of mature AvBD1 peptide, while posttranslational modifications were absent in bone marrow-derived mature AvBD2 peptide. Furthermore, mass spectrometry analysis performed on intact cells confirmed the presence of these three peptides in mature heterophils. In addition, the antibacterial activities of the three beta-defensins against a large panel of gram-positive and -negative bacteria were assessed. While the three defensins displayed similar antibacterial spectra of activity against gram-positive strains, AvBD1 and AvBD7 exhibited the strongest activity against gram-negative strains in comparison to AvBD2.
Online Inquiry
Verification code
Inquiry Basket