Need Assistance?
  • US & Canada:
    +
  • UK: +

Dendrocin

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Dendrocin is an antibacterial peptide isolated from Dendrocalamus latiflorus Munro. It has activity against fungi.

Category
Functional Peptides
Catalog number
BAT-012747
Molecular Formula
C182H273N43O48S
Molecular Weight
3863.49
Synonyms
Thr-Thr-Leu-Thr-Leu-His-Asn-Leu-Cys-Pro-Tyr-Pro-Val-Trp-Trp-Leu-Val-Thr-Pro-Asn-Asn-Gly-Gly-Phe-Pro-Ile-Ile-Asp-Asn-Thr-Pro-Val-Val-Leu-Gly
Sequence
TTLTLHNLCPYPVWWLVTPNNGGFPIIDNTPVVLG
1. Dendrocin, a distinctive antifungal protein from bamboo shoots
H X Wang, T B Ng Biochem Biophys Res Commun. 2003 Aug 1;307(3):750-5. doi: 10.1016/s0006-291x(03)01229-4.
An antifungal protein, with a molecular weight of 20 kDa and an inhibitory action on mycelial growth in the fungi Fusarium oxysporum, Botrytis cincerea, and Mycosphaerella arachidicola, was isolated from fresh bamboo shoots. The protein, designated dendrocin, was unadsorbed on DEAE-cellulose and adsorbed on Affi-gel blue gel and CM-Sepharose. Dendrocin showed only limited similarity in N-terminal sequence to thaumatin-like proteins, unlike other thaumatin-like proteins which closely resemble each other. Its molecular weight was also lower than those of the previously reported thaumatin-like proteins. The protein was devoid of hemagglutinating and ribonuclease activities found in some antifungal proteins.
2. Isolation and Chemical Characterization of an Alpha-Helical Peptide, Dendrocin-ZM1, Derived from Zataria multiflora Boiss with Potent Antibacterial Activity
Sima Sadat Seyedjavadi, et al. Probiotics Antimicrob Proteins. 2022 Apr;14(2):326-336. doi: 10.1007/s12602-022-09907-7. Epub 2022 Jan 20.
Today, resistance of microorganisms to antibiotics has become a major challenge. To overcome this problem, development of new drugs, besides research on their antibacterial activity, is essential. Among chemical components, antimicrobial peptides (AMPs) exhibit antibacterial activity and can be selected as suitable antimicrobial candidates. In this study, a novel antimicrobial peptide, called dendrocin-ZM1, with a molecular weight of ~3716.48 Da, was isolated from Zataria multiflora Boiss (ZM) and purified via precipitation with ammonium sulfate and reverse-phase HPLC chromatography; it was then sequenced via Edman degradation. The in silico method was used to examine the physicochemical properties of dendrocin-ZM1. In this study, four reference strains (gram-positive and gram-negative) and one clinical vancomycin-resistant Staphylococcus aureus strain were used to survey the antimicrobial activities. Moreover, to examine cytotoxicity and hemolytic activity, a HEK-293 cell line and human red blood cells (RBCs) were used, respectively. Evaluation of the physicochemical properties of dendrocin-ZM1, as an AMP, indicated a net charge of + 7 and a hydrophobicity percentage of 54%. This peptide had an amphipathic alpha-helical conformation. It exhibited broad-spectrum antibacterial activities against the tested strains at minimum inhibitory concentrations (MICs) of 4-16 μg/mL. Besides, this peptide showed negligible hemolysis and cytotoxicity in the MIC range. It also exhibited heat stability at temperatures of 20 to 80 °C and was active in a broad pH range (from 6.0 to 10.0). Overall, the present results suggested dendrocin-ZM1 as a remarkable antimicrobial candidate.
Online Inquiry
Verification code
Inquiry Basket