Esculentin-2-OG5 antimicrobial peptide
Need Assistance?
  • US & Canada:
    +
  • UK: +

Esculentin-2-OG5 antimicrobial peptide

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Esculentin-2-OG5 antimicrobial peptide is produced by Rana grahami.

Category
Functional Peptides
Catalog number
BAT-012230
Sequence
GLFTLIKGAAKLIGRTVAKEAGKTGLELMACKITNQC
1. Mini Review on Antimicrobial Peptides, Sources, Mechanism and Recent Applications
Jaspreet Kaur Boparai, Pushpender Kumar Sharma Protein Pept Lett. 2020;27(1):4-16. doi: 10.2174/0929866526666190822165812.
Antimicrobial peptides in recent years have gained increased interest among scientists, health professionals and the pharmaceutical companies owing to their therapeutic potential. These are low molecular weight proteins with broad range antimicrobial and immuno modulatory activities against infectious bacteria (Gram positive and Gram negative), viruses and fungi. Inability of micro-organisms to develop resistance against most of the antimicrobial peptide has made them as an efficient product which can greatly impact the new era of antimicrobials. In addition to this these peptides also demonstrates increased efficacy, high specificity, decreased drug interaction, low toxicity, biological diversity and direct attacking properties. Pharmaceutical industries are therefore conducting appropriate clinical trials to develop these peptides as potential therapeutic drugs. More than 60 peptide drugs have already reached the market and several hundreds of novel therapeutic peptides are in preclinical and clinical development. Rational designing can be used further to modify the chemical and physical properties of existing peptides. This mini review will discuss the sources, mechanism and recent therapeutic applications of antimicrobial peptides in treatment of infectious diseases.
2. The Modification and Design of Antimicrobial Peptide
Yidan Gao, Hengtong Fang, Lu Fang, Dawei Liu, Jinsong Liu, Menghan Su, Zhi Fang, Wenzhi Ren, Huping Jiao Curr Pharm Des. 2018;24(8):904-910. doi: 10.2174/1381612824666180213130318.
The antimicrobial peptides (AMPs) are a group of unique naturally occurring anti-microbial compounds with around 50 amino acids. It represents promising therapeutic agents to the infectious disease without concerning about drug resistance. However, commercial development of these peptides for even the simplest application has been hindered by the limitations of sources, instability, toxicity and bioavailability. To improve the properties of the artificial synthesized AMPs, the modification and design are the hotspots of the AMPs research. In fact, more than half of the known AMPs are naturally modified. In this review, two types of modification strategies, biochemical modification and chemical modification were summarized. Although, the chemical modification is versatile and direct, the manufacturing cost is greatly increased compared to the antibiotics. With the recent progress of the protein modification enzyme, the biochemical modification of the antimicrobial peptide followed by heterologous expression has great application prospects.
3. Antimicrobial Peptides: An Update on Classifications and Databases
Ahmer Bin Hafeez, Xukai Jiang, Phillip J Bergen, Yan Zhu Int J Mol Sci. 2021 Oct 28;22(21):11691. doi: 10.3390/ijms222111691.
Antimicrobial peptides (AMPs) are distributed across all kingdoms of life and are an indispensable component of host defenses. They consist of predominantly short cationic peptides with a wide variety of structures and targets. Given the ever-emerging resistance of various pathogens to existing antimicrobial therapies, AMPs have recently attracted extensive interest as potential therapeutic agents. As the discovery of new AMPs has increased, many databases specializing in AMPs have been developed to collect both fundamental and pharmacological information. In this review, we summarize the sources, structures, modes of action, and classifications of AMPs. Additionally, we examine current AMP databases, compare valuable computational tools used to predict antimicrobial activity and mechanisms of action, and highlight new machine learning approaches that can be employed to improve AMP activity to combat global antimicrobial resistance.
Online Inquiry
Verification code
Inquiry Basket