Need Assistance?
  • US & Canada:
    +
  • UK: +

Latescidin 1

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Latescidin 1 is an antibacterial peptide isolated from Lates calcarifer.

Category
Functional Peptides
Catalog number
BAT-012602
Synonyms
Leu-Glu-Glu-Ala-Gly-Ser-Asn-Asp-Thr-Pro-Val-Ala-Ala-His-Gln-Glu-Met-Ser-Met-Glu-Ser-Trp-Met-Met-Pro-Asn-His-Ile-Arg-Gln-Lys-Arg-Gln-Ser-His-Leu-Ser-Leu
Purity
97.6%
Sequence
LEEAGSNDTPVAAHQEMSMESWMMPNHIRQKRQSHLSL
Storage
Store at -20°C
1. Effectiveness of High-Intensity Interval Training (HIT) and Continuous Endurance Training for VO2max Improvements: A Systematic Review and Meta-Analysis of Controlled Trials
Zoran Milanović, Goran Sporiš, Matthew Weston Sports Med. 2015 Oct;45(10):1469-81. doi: 10.1007/s40279-015-0365-0.
Background: Enhancing cardiovascular fitness can lead to substantial health benefits. High-intensity interval training (HIT) is an efficient way to develop cardiovascular fitness, yet comparisons between this type of training and traditional endurance training are equivocal. Objective: Our objective was to meta-analyse the effects of endurance training and HIT on the maximal oxygen consumption (VO2max) of healthy, young to middle-aged adults. Methods: Six electronic databases were searched (MEDLINE, PubMed, SPORTDiscus, Web of Science, CINAHL and Google Scholar) for original research articles. A search was conducted and search terms included 'high intensity', 'HIT', 'sprint interval training', 'endurance training', 'peak oxygen uptake', and 'VO2max'. Inclusion criteria were controlled trials, healthy adults aged 18-45 years, training duration ≥2 weeks, VO2max assessed pre- and post-training. Twenty-eight studies met the inclusion criteria and were included in the meta-analysis. This resulted in 723 participants with a mean ± standard deviation (SD) age and initial fitness of 25.1 ± 5 years and 40.8 ± 7.9 mL·kg(-1)·min(-1), respectively.
2. Cataract prevalence and prevention in Europe: a literature review
Elena Prokofyeva, Alfred Wegener, Eberhart Zrenner Acta Ophthalmol. 2013 Aug;91(5):395-405. doi: 10.1111/j.1755-3768.2012.02444.x. Epub 2012 Jun 20.
This literature review is aimed at the evaluation of the potential for cataract prevention in Europe. It was performed using PubMed with Mesh and free-text terms. Studies included were (i) performed on a population of Caucasian origin at an age range of 40-95 years, (ii) cataract was clinically verified, (iii) drug record of prescriptions, their indication, a record of every diagnosis, dosage and quantity of prescribed medicine were available, (iv) sample size >300 and (v) published between 1990 and 2009. The results of 29 articles were reviewed. Former [3.75 (2.26-6.21)] or current smoking [2.34 (1.07-5.15)], diabetes of duration >10 years [2.72 (1.72-4.28)], asthma or chronic bronchitis [2.04 (1.04-3.81)], and cardiovascular disease [1.96 (1.22-3.14)] increased the risk of cataract. Cataract was more common in patients taking chlorpromazine during ≥90 days with a dosage ≥300 mg [8.8 (3.1-25.1)] and corticosteroids >5 years [3.25 (1.39-7.58)] in a daily dose >1600 mg [1.69 (1.17-2.43)]. Intake of a multivitamin/mineral formulation [2.00 (1.35-2.98)] or corticosteroids [2.12 (1.93-2.33)] also increased the risk of cataract. Corticosteroids applied orally [3.25 (1.39-7.58)], parenteral [1.56 (1.34-1.82)] or inhalational [1.58 (1.46-1.71)] lead to cataract more frequently than those applied topically: nasal [1.33 (1.21-1.45)], ear [1.31 (1.19-1.45)] or skin [1.43 (1.36-1.50)]. Outpatient cataract surgery was negatively associated with total cataract surgery costs, and chlorpromazine, corticosteroids and multivitamin/mineral formation increase the risk of posterior subcapsular cataract dependent on dose, treatment application and duration. This review presented a comprehensive overview of specific and general cataract risk factors and an update on most recent experimental studies and randomized control trials directed at cataract prevention.
Online Inquiry
Verification code
Inquiry Basket