Palustrin-2ISb precursor protein
Need Assistance?
  • US & Canada:
    +
  • UK: +

Palustrin-2ISb precursor protein

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Palustrin-2ISb precursor protein is an antimicrobial peptide found in Odorrana ishikawae (Ishikawa frog), and has antibacterial and antifungal activity.

Category
Functional Peptides
Catalog number
BAT-011690
Molecular Formula
C172H287N47O47S2
Molecular Weight
3829.59
Synonyms
Leu-Trp-Asn-Ser-Ile-Lys-Ile-Ala-Gly-Lys-Lys-Leu-Phe-Val-Asn-Val-Leu-Asp-Lys-Ile-Arg-Cys-Lys-Val-Ala-Gly-Gly-Cys-Lys-Thr-Ser-Pro-Asp-Val-Glu
Appearance
Powder
Purity
≥97%
Sequence
LWNSIKIAGKKLFVNVLDKIRCKVAGGCKTSPDVE (Disulfide bridge: Cys22-Cys28)
Storage
Store at -20°C
1. A novel antimicrobial peptide from amphibian skin secretions of Odorrana grahami
Qiaolin Che, Yu Zhou, Hailong Yang, Jianxu Li, Xueqing Xu, Ren Lai Peptides. 2008 Apr;29(4):529-35. doi: 10.1016/j.peptides.2008.01.004. Epub 2008 Jan 17.
A novel antimicrobial peptide named odorranain-NR was identified from skin secretions of the diskless odorous frog, Odorrana grahami. It is composed of 23 amino acids with an amino acid sequence of GLLSGILGAGKHIVCGLTGCAKA. Odorranain-NR was classified into a novel family of antimicrobial peptide although it shared similarity with amphibian antimicrobial peptide family of nigrocin. Odorranain-NR has an unusual intramolecular disulfide-bridged hexapeptide segment that is different from the intramolecular disulfide-bridged heptapeptide segment at the C-terminal end of nigrocins. Furthermore, the -AKA fragment at the C-terminal of odorranain-NR is also different from nigrocins. Three different cDNAs encoding two odorranain-NR precursors and only one mature odorranain-NR was cloned from the cDNA library of the skin of O. grahami. This peptide showed antimicrobial activities against tested microorganisms except Escherichia coli (ATCC25922). Its antimicrobial mechanisms were investigated by transmission electron microcopy. Odorranain-NR exerted its antimicrobial functions by various means depending on different microorganisms.
2. Characterization of novel antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae by shotgun cDNA cloning
Eiko Iwakoshi-Ukena, Miyuki Soga, Genya Okada, Tamotsu Fujii, Masayuki Sumida, Kazuyoshi Ukena Biochem Biophys Res Commun. 2011 Sep 9;412(4):673-7. doi: 10.1016/j.bbrc.2011.08.023. Epub 2011 Aug 16.
We recently reported the primary structures, antimicrobial activities and cDNA precursors of nine novel antimicrobial peptides from the skin of the endangered anuran species, Odorranaishikawae. Their cDNA clones revealed a highly conserved approximately 60 bp region upstream of the start codon. This conserved region was used in the "shotgun" cDNA cloning method to reveal additional cDNAs encoding novel antimicrobial peptides of O.ishikawae. After sequencing 344 clones, we identified novel 13 cDNAs encoding dermal peptides in addition to the previously identified nine antimicrobial peptides. These 13 unique cDNAs encoded precursor proteins each containing a signal peptide, an N-terminal acidic spacer domain, a Lys-Arg/Lys processing site and a dermal peptide at the C-terminus. The dermal peptides were members of the palustrin-2 (two peptides; termed palustrin-2ISc and palustrin-2ISd), nigrocin-2 (one peptide; nigrocin-2ISc), brevinin-1 (one peptide; brevinin-1ISa), odorranain-M (one peptide; odorranain-MISa) and entirely novel peptides (eight peptides; ishikawain-1-8). Although palustrin-2ISd and odorranain-MISa had few antimicrobial activities, palustrin-2ISc and nigrocin-2ISc possessed a broad-spectrum of growth inhibition against bacteria. Brevinin-1ISa had the most potent antimicrobial activities against the Gram-positive bacteria and the fungus but not the Gram-negative bacterium, Escherichiacoli. However, eight novel peptides showed no growth inhibition against these microorganisms.
3. Identification and characterization of antimicrobial peptides from the skin of the endangered frog Odorrana ishikawae
Eiko Iwakoshi-Ukena, Kazuyoshi Ukena, Aiko Okimoto, Miyuki Soga, Genya Okada, Naomi Sano, Tamotsu Fujii, Yoshiaki Sugawara, Masayuki Sumida Peptides. 2011 Apr;32(4):670-6. doi: 10.1016/j.peptides.2010.12.013. Epub 2010 Dec 28.
The endangered anuran species, Odorrana ishikawae, is endemic to only two small Japanese Islands, Amami and Okinawa. To assess the innate immune system in this frog, we investigated antimicrobial peptides in the skin using artificially bred animals. Nine novel antimicrobial peptides containing the C-terminal cyclic heptapeptide domain were isolated on the basis of antimicrobial activity against Escherichia coli. The peptides were members of the esculentin-1 (two peptides), esculentin-2 (one peptide), palustrin-2 (one peptide), brevinin-2 (three peptides) and nigrocin-2 (two peptides) antimicrobial peptide families. They were named esculentin-1ISa, esculentin-1ISb, esculentin-2ISa, palustrin-2ISa, brevinin-2ISa, brevinin-2ISb, brevinin-2ISc, nigrocin-2ISa and nigrocin-2ISb. Peptide primary structures suggest a close relationship with the Asian odorous frogs, Odorrana grahami and Odorrana hosii. These antimicrobial peptides possessed a broad-spectrum of growth inhibition against five microorganisms (E. coli, Staphylococcus aureus, methicillin-resistant S. aureus, Bacillus subtilis and Candida albicans). Nine different cDNAs encoding the precursor proteins were also cloned and showed that the precursor proteins exhibited a signal peptide, an N-terminal acidic spacer domain, a Lys-Arg processing site and an antimicrobial peptide at the C-terminus.
Online Inquiry
Verification code
Inquiry Basket