Cyclotide vibi-E
Need Assistance?
  • US & Canada:
    +
  • UK: +

Cyclotide vibi-E

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

Cyclotide vibi-E is produced by Viola biflora. It probably participates in a plant defense mechanism. Cyclotide vibi-E has cytotoxic activity, active against a human lymphoma cell line with an IC50 of 3.2 µM.

Category
Functional Peptides
Catalog number
BAT-012344
Sequence
GIPCAESCVWIPCTVTALIGCGCSNKVCYN
1. Cyclotide biosynthesis
David J Craik, Uru Malik Curr Opin Chem Biol. 2013 Aug;17(4):546-54. doi: 10.1016/j.cbpa.2013.05.033. Epub 2013 Jun 25.
Cyclotides are bioactive macrocyclic peptides from plants that are characterized by their exceptional stability and potential applications as protein engineering or drug design frameworks. Their stability arises from their unique cyclic cystine knot structure, which combines a head-to-tail cyclic peptide backbone with three conserved disulfide bonds having a knotted topology. Cyclotides are ribosomally synthesized by plants and expressed in a wide range of tissues, including leaves, flowers, stems and roots. Here we describe recent studies that have examined the biosynthesis of cyclotides and in particular the mechanism associated with post-translational backbone cyclization.
2. Pharmaceutical applications of cyclotides
Paola G Ojeda, Marlon H Cardoso, Octávio L Franco Drug Discov Today. 2019 Nov;24(11):2152-2161. doi: 10.1016/j.drudis.2019.09.010. Epub 2019 Sep 18.
Cyclotides are cyclic peptides, present in several plant families, that show diverse biological properties. Structurally, cyclotides share a distinctive head-to-tail circular knotted topology of three disulfide bonds. This framework provides cyclotides with extraordinary resistance to thermal and chemical denaturation. There is increasing interest in the therapeutic potential of cyclotides, which combine several promising pharmaceutical properties, including binding affinity, target selectivity, and low toxicity towards healthy mammalian cells. Recently, cyclotides have been reported to be orally bioavailable and have proved to be amenable to modifications. Here, we provide an overview of the structure, properties, and pharmaceutical applications of cyclotides.
3. Butterfly Pea ( Clitoria ternatea), a Cyclotide-Bearing Plant With Applications in Agriculture and Medicine
Georgianna K Oguis, Edward K Gilding, Mark A Jackson, David J Craik Front Plant Sci. 2019 May 28;10:645. doi: 10.3389/fpls.2019.00645. eCollection 2019.
The perennial leguminous herb Clitoria ternatea (butterfly pea) has attracted significant interest based on its agricultural and medical applications, which range from use as a fodder and nitrogen fixing crop, to applications in food coloring and cosmetics, traditional medicine and as a source of an eco-friendly insecticide. In this article we provide a broad multidisciplinary review that includes descriptions of the physical appearance, distribution, taxonomy, habitat, growth and propagation, phytochemical composition and applications of this plant. Notable amongst its repertoire of chemical components are anthocyanins which give C. ternatea flowers their characteristic blue color, and cyclotides, ultra-stable macrocyclic peptides that are present in all tissues of this plant. The latter are potent insecticidal molecules and are implicated as the bioactive agents in a plant extract used commercially as an insecticide. We include a description of the genetic origin of these peptides, which interestingly involve the co-option of an ancestral albumin gene to produce the cyclotide precursor protein. The biosynthesis step in which the cyclic peptide backbone is formed involves an asparaginyl endopeptidase, of which in C. ternatea is known as butelase-1. This enzyme is highly efficient in peptide ligation and has been the focus of many recent studies on peptide ligation and cyclization for biotechnological applications. The article concludes with some suggestions for future studies on this plant, including the need to explore possible synergies between the various peptidic and non-peptidic phytochemicals.
Online Inquiry
Verification code
Inquiry Basket