Need Assistance?
  • US & Canada:
    +
  • UK: +

OaBac6

* Please kindly note that our products are not to be used for therapeutic purposes and cannot be sold to patients.

OaBac6 is an antimicrobial peptide found in Ovis aries (Sheep). It has antimicrobial activity against gram-negative bacteria and gram-positive bacteria.

Category
Functional Peptides
Catalog number
BAT-011777
Molecular Formula
C297H464N90O57
Molecular Weight
6207.52
Synonyms
Bac6; Bactinecin 6
Purity
>98%
Sequence
RRLRPRHQHFPSERPWPKPLPLPLPRPGPRPWPKPLPLPLPRPGLRPWPKPL
Storage
Store at -20°C
1. The human beta-defensin-1 and alpha-defensins are encoded by adjacent genes: two peptide families with differing disulfide topology share a common ancestry
L Liu, C Zhao, H H Heng, T Ganz Genomics. 1997 Aug 1;43(3):316-20. doi: 10.1006/geno.1997.4801.
We cloned a novel human beta-defensin gene and determined its full-length cDNA sequence. The entire gene spanned more than 7 kb and included a large 6962-bp intron. The 362-bp cDNA encoded a prepropeptide that corresponded precisely to the recently identified human beta-defensin HBD-1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. By two-color fluorescence in situ hybridization on both metaphase chromosome and released chromatin fiber, HBD-1 gene (DEFB1 in HUGO/GDB nomenclature) mapped to chromosomal region 8p23.1-p23.2 in close proximity (within 100-150 kb) to the gene for the human neutrophil alpha-defensin HNP-1 (DEFA1). Thus, despite a complete lack of DNA sequence similarity and despite differences in their disulfide-pairing pattern, the alpha- and beta-families appear to have evolved from a common premammalian defensin gene.
2. Isolation and characterisation of proline/arginine-rich cathelicidin peptides from ovine neutrophils
Rachel C Anderson, Pak-Lam Yu Biochem Biophys Res Commun. 2003 Dec 26;312(4):1139-46. doi: 10.1016/j.bbrc.2003.11.045.
Cathelicidins are a family of gene-encoded antimicrobial peptides found in mammals. Seven cathelicidin genes have been identified in sheep, but up to now only two variants of one of these predicted peptides (OaBac5) have been purified from ovine neutrophils. In this work numerous proline/arginine-rich cathelicidin peptides were purified, including the originally predicted OaBac5 and another OaBac5 variant. As well as this, the C-terminus of the predicted OaBac7.5 and various truncated forms of OaBac11 were purified. Even though these peptides were much smaller than those predicted, they still displayed antimicrobial activity.
3. Identification and expression analysis of the β-defensin genes in the goat small intestine
Long Zhang, Haihong Xiao, Jian Huang, Linghua Ouyang, Siming Li, Yanqiang Tang Gene. 2021 Oct 30;801:145846. doi: 10.1016/j.gene.2021.145846. Epub 2021 Jul 16.
Defensins represent a family of cysteine-rich peptides that have broad-spectrum antimicrobial activities and serve as a typical kind of effector molecule in the immunity. Ruminant species have a large number of β-defensins in the absence of α- and θ-defensins. It is well-known that the genomes of sheep and cattle harbor at least 43 and 57 β-defensin genes, respectively. However, the repertoire of the goat β-defensin gene family has not been fully elucidated. In this study, we identified a total of 50 β-defensins from the goat genome, including 48 functional genes and 2 pseudogenes. Cross-species genomic and evolutionary analyses showed that all of the β-defensins in goat chromosomes 8, 13 and 23 present one-to-one orthologous relationships to their sheep and cattle counterparts, whereas some β-defensin genes in goat chromosome 27 are goat-specific. Moreover, we observed that some duplicated genes in goat chromosome 27 may be derived from gene copy number variation, and the annotation of sheep and cattle β-defensins appears to be incomplete in the genome. Importantly, real-time PCR analysis showed that 17 β-defensins are expressed in the small intestine with abundant cBD1s expression. These findings significant increased our knowledge of ruminant β-defensin and provided useful information for genetic studies, as well as providing a foundation for future research exploring the role of defensins in the immune response.
Online Inquiry
Verification code
Inquiry Basket